DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15930 and TDRKH

DIOPT Version :9

Sequence 1:NP_572214.2 Gene:CG15930 / 31446 FlyBaseID:FBgn0029754 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001077432.1 Gene:TDRKH / 11022 HGNCID:11713 Length:561 Species:Homo sapiens


Alignment Length:470 Identity:93/470 - (19%)
Similarity:152/470 - (32%) Gaps:143/470 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GRLQTLLSKLRK-----ISEEAEDNND--------VPLDLRCPSAKMRNNKVLAD---LSDMLKV 58
            ||....:.:|||     |..:.||..|        .|:.: | .||...:::|.:   :|:.|.|
Human    69 GRQGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQV-C-KAKAAIHQILTENTPVSEQLSV 131

  Fly    59 V------------EDIALEEKTTDSKKPANSEQQINGTIELALDLRQPNAKIRLVISDSSDLQKV 111
            .            |.|....|.:.:|...:.|.:  ||:.|:          || |..|...::|
Human   132 PQRSVGRIIGRGGETIRSICKASGAKITCDKESE--GTLLLS----------RL-IKISGTQKEV 183

  Fly   112 FEKAHIALELKTTDSKPTAETDDQHHVRIFDKMLCNIVVPPDVADVQVNGKPLEQLLATVSERQA 176
            ....|:.|| |.::       |::...||...           |:.:|   |.:|.::.  .|:.
Human   184 AAAKHLILE-KVSE-------DEELRKRIAHS-----------AETRV---PRKQPISV--RRED 224

  Fly   177 MNNPGPMKMHELHTGNADFMNSNSQVAEAAASVETLLASTSDNDSD------SDGLESKTTDGYI 235
            |..||       ..|......:.|...|..|   .|:........|      .:|...|.:|...
Human   225 MTEPG-------GAGEPALWKNTSSSMEPTA---PLVTPPPKGGGDMAVVVSKEGSWEKPSDDSF 279

  Fly   236 VKELIPSFSDFPDIGDVSLCALMYGLPMDAVGMHWKLPPQRIQDICKEDSIFPIIMSCVFSPCEF 300
            .|....:..:.|          |:.:|......|             .|....:.:|....|..|
Human   280 QKSEAQAIPEMP----------MFEIPSPDFSFH-------------ADEYLEVYVSASEHPNHF 321

  Fly   301 WFHIV-------------PPQYAKNPVAE-MTIDLNWFYRHTTISSYRAELPSYFYKEGYICAAY 351
            |..||             ..|:.:|.|.| :|:.:.        ....|.||             
Human   322 WIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVHVG--------DIVAAPLP------------- 365

  Fly   352 SECGWRRAMVLVTAPLDAQCVNIEYVDHALSVTLAPNHLRFLPLSFARTPPLVFRGKMSHVRPLA 416
            :...|.||.||.|  |:...:::.:||...:.......||.|...|...|.......::.:.|..
Human   366 TNGSWYRARVLGT--LENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECSLARIAPSG 428

  Fly   417 NGWPKNGITAFQRMT 431
            :.|.:..:..|.|:|
Human   429 DQWEEEALDEFDRLT 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15930NP_572214.2 TUDOR 281..411 CDD:278965 29/143 (20%)
TDRKHNP_001077432.1 KH-I 54..116 CDD:238053 13/48 (27%)
KH-I 126..191 CDD:238053 17/77 (22%)
UPF0561 <192..249 CDD:287535 17/90 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..262 10/54 (19%)
TUDOR 303..422 CDD:278965 30/154 (19%)
TUDOR 357..404 CDD:119391 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.