DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and PDIA4

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001358173.1 Gene:PDIA4 / 9601 HGNCID:30167 Length:646 Species:Homo sapiens


Alignment Length:83 Identity:30/83 - (36%)
Similarity:44/83 - (53%) Gaps:7/83 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KLIVLDFYATWCGPCKEMESTVKSLARKYSSK--AVVLKIDVDKFEELTERYKVRSMPTFVFL-- 80
            |.::::|||.|||.||::|....|||:||..:  .|:.|:|....:..::||||...||..|.  
Human   545 KDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPTIYFAPS 609

  Fly    81 RQNRRLASFAGAD---EH 95
            ...:....|.|.|   ||
Human   610 GDKKNPVKFEGGDRDLEH 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 27/76 (36%)
PDIA4NP_001358173.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..58
pdi_dom 67..168 CDD:273454
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 91..94
ER_PDI_fam 177..641 CDD:273457 30/83 (36%)
CXXC. /evidence=ECO:0000250|UniProtKB:P08003 556..559 2/2 (100%)
Prevents secretion from ER 643..646
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.