DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TRX2

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_011725.3 Gene:TRX2 / 853123 SGDID:S000003441 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:105 Identity:34/105 - (32%)
Similarity:63/105 - (60%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEEL 65
            :..:::.::|...: |:.|||:|:||:||||||||.:...::..|.:||. |...|:|||:..::
Yeast     2 VTQLKSASEYDSAL-ASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSD-AAFYKLDVDEVSDV 64

  Fly    66 TERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAKLV 105
            .::.:|.||||.:|.:..:.:....||:...:...:|..|
Yeast    65 AQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASNV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 29/75 (39%)
TRX2NP_011725.3 thioredoxin 6..104 CDD:200072 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
87.630

Return to query results.
Submit another query.