DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TRX1

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_013144.1 Gene:TRX1 / 850732 SGDID:S000004033 Length:103 Species:Saccharomyces cerevisiae


Alignment Length:98 Identity:32/98 - (32%)
Similarity:59/98 - (60%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERY 69
            :|.:::...|  |.|||:|:|||||||||||.:...::..:.:| .:|...|:|||:..::.::.
Yeast     6 KTASEFDSAI--AQDKLVVVDFYATWCGPCKMIAPMIEKFSEQY-PQADFYKLDVDELGDVAQKN 67

  Fly    70 KVRSMPTFVFLRQNRRLASFAGADEHKLTNMMA 102
            :|.:|||.:..:..:.:|...||:...:...:|
Yeast    68 EVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 28/75 (37%)
TRX1NP_013144.1 thioredoxin 6..103 CDD:200072 32/98 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.