DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TRX3

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_010006.1 Gene:TRX3 / 850444 SGDID:S000000679 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:104 Identity:34/104 - (32%)
Similarity:54/104 - (51%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDY-----------HKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVV 54
            :.|:|..:.|           .:.:...:||| |:|||||||||||.|:..:..|.:.|.....|
Yeast    15 LKSIRFQSSYTSITKLTNLTEFRNLIKQNDKL-VIDFYATWCGPCKMMQPHLTKLIQAYPDVRFV 78

  Fly    55 LKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGAD 93
             |.|||:..::.:..:|.:|||||..:..:.:....||:
Yeast    79 -KCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGAN 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 30/75 (40%)
TRX3NP_010006.1 TRX_family 35..125 CDD:239245 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
87.610

Return to query results.
Submit another query.