DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TY1

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_177802.2 Gene:TY1 / 844010 AraportID:AT1G76760 Length:172 Species:Arabidopsis thaliana


Alignment Length:94 Identity:30/94 - (31%)
Similarity:49/94 - (52%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KRIEAA-------------DDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFE 63
            :||||.             .||.:::|:||||||||:.|...:..::.....|..|:|||.:|:.
plant    61 RRIEAKKQTFDSFEDLLVNSDKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYP 125

  Fly    64 ELTERYKVRSMPTFVFLRQNRRLASFAGA 92
            .:..:||:.::|||:..:.......|.||
plant   126 SIANKYKIEALPTFILFKDGEPCDRFEGA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 26/89 (29%)
TY1NP_177802.2 Thioredoxin_like 69..168 CDD:412351 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.