DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TH8

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_177146.1 Gene:TH8 / 843324 AraportID:AT1G69880 Length:148 Species:Arabidopsis thaliana


Alignment Length:109 Identity:34/109 - (31%)
Similarity:59/109 - (54%) Gaps:3/109 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDYHKRIEAADD--KLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFE 63
            :..::.||.:..|:.|..|  ||:|::|.|.||||||.:|..::.||.||:....| |||||...
plant    39 IVEIKNMNQWKSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFV-KIDVDVLM 102

  Fly    64 ELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAKLVKA 107
            .:...:.:.::|..||:::.|.:....|....:|...:.|..::
plant   103 SVWMEFNLSTLPAIVFMKRGREVDMVVGVKVDELERKLNKYTQS 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 28/77 (36%)
TH8NP_177146.1 TRX_family 52..141 CDD:239245 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.