DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TH7

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_176182.1 Gene:TH7 / 842266 AraportID:AT1G59730 Length:129 Species:Arabidopsis thaliana


Alignment Length:119 Identity:36/119 - (30%)
Similarity:61/119 - (51%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASVRTMNDYHKRIE-----------------------AADDKLIVLDFYATWCGPCKEMESTVKS 43
            ::|.:::|.|..:|                       ...:||:|:||.|.||||||.||..|:.
plant     3 SNVSSVHDVHSSMEITSNGFVVEIESRRQWKSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVRE 67

  Fly    44 LARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKL 97
            :|.|| |:||..::|||:..::...|:..::|.|||:::...:....||...:|
plant    68 IASKY-SEAVFARVDVDRLMDVAGTYRAITLPAFVFVKRGEEIDRVVGAKPDEL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 30/75 (40%)
TH7NP_176182.1 TRX_family 36..125 CDD:239245 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.