powered by:
Protein Alignment dhd and THX
DIOPT Version :9
Sequence 1: | NP_001284882.1 |
Gene: | dhd / 31444 |
FlyBaseID: | FBgn0011761 |
Length: | 107 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_564566.1 |
Gene: | THX / 841454 |
AraportID: | AT1G50320 |
Length: | 182 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 23/73 - (31%) |
Similarity: | 45/73 - (61%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 IEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFV 78
:|:|.. ::::|.||||||||.:...:::|:::|..|..::|||.|...:|...:||..:|.|:
plant 84 LESAQP--VLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFI 146
Fly 79 FLRQNRRL 86
..:..:.:
plant 147 LFKDGKEV 154
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000170 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100096 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.780 |
|
Return to query results.
Submit another query.