DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TRX5

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_175128.1 Gene:TRX5 / 841082 AraportID:AT1G45145 Length:118 Species:Arabidopsis thaliana


Alignment Length:100 Identity:32/100 - (32%)
Similarity:64/100 - (64%) Gaps:3/100 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TMNDYHKRIEAADD--KLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTER 68
            |:..::::::.|::  ||||:||.|:||.||:.:......:|:|::: .|..|||||:.:.:.:.
plant    12 TLEVWNEKVKDANESKKLIVIDFTASWCPPCRFIAPVFAEMAKKFTN-VVFFKIDVDELQAVAQE 75

  Fly    69 YKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
            :||.:||||||:::...:....||.:.::...:.|
plant    76 FKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 29/77 (38%)
TRX5NP_175128.1 TRX_family 16..108 CDD:239245 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.