DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and ACHT4

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_172333.1 Gene:ACHT4 / 837379 AraportID:AT1G08570 Length:275 Species:Arabidopsis thaliana


Alignment Length:106 Identity:26/106 - (24%)
Similarity:52/106 - (49%) Gaps:4/106 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEEL 65
            |..:.:..:....:..|.|||:|:||::..||.||.:...:...| :.:.....|:::.::.:.:
plant    99 MREISSAQELVDSLTNAGDKLVVVDFFSPGCGGCKALHPKICQFA-EMNPDVQFLQVNYEEHKSM 162

  Fly    66 TERYKVRSMPTFVFLRQNR-RLASFA--GADEHKLTNMMAK 103
            .....|..:|.|.|.|.:: |:.||:  .|...|..:.:||
plant   163 CYSLGVHVLPFFRFYRGSQGRVCSFSCTNATIKKFRDALAK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 21/78 (27%)
ACHT4NP_172333.1 TRX_family 115..202 CDD:239245 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.