powered by:
Protein Alignment dhd and AT4G12170
DIOPT Version :9
Sequence 1: | NP_001284882.1 |
Gene: | dhd / 31444 |
FlyBaseID: | FBgn0011761 |
Length: | 107 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_192954.2 |
Gene: | AT4G12170 / 826825 |
AraportID: | AT4G12170 |
Length: | 153 |
Species: | Arabidopsis thaliana |
Alignment Length: | 59 |
Identity: | 15/59 - (25%) |
Similarity: | 27/59 - (45%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 IVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMP-TFVF 79
:::.|.|..|..|..:...::.|..:|........:|.|:..||.:.|::...| |.||
plant 70 VIVVFIAKDCAECGSLMPELEFLDSEYEYMLKFYTVDTDEELELAKDYRIEYHPITIVF 128
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dhd | NP_001284882.1 |
TRX_family |
17..93 |
CDD:239245 |
15/59 (25%) |
AT4G12170 | NP_192954.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.880 |
|
Return to query results.
Submit another query.