DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and AT3G56420

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001325846.1 Gene:AT3G56420 / 824809 AraportID:AT3G56420 Length:154 Species:Arabidopsis thaliana


Alignment Length:101 Identity:31/101 - (30%)
Similarity:58/101 - (57%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRTMNDYHKRIEAADD--KLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELT 66
            |..:..:.::|..|::  |::|::|.|.||.|||::|...:.||.:|.| .:.:.:||::..|.:
plant    45 VSRIEKWEEKITEANNHGKILVVNFSAPWCVPCKKIEPVFRDLASRYPS-MIFVTVDVEELAEFS 108

  Fly    67 ERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMA 102
            ..:.|.:.||.|||:..|::....||:..:|....|
plant   109 NEWNVEATPTVVFLKDGRQMDKLVGAETSELQKKTA 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 26/77 (34%)
AT3G56420NP_001325846.1 TRX_family 49..142 CDD:239245 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.