DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and AT3G53220

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_566982.1 Gene:AT3G53220 / 824488 AraportID:AT3G53220 Length:126 Species:Arabidopsis thaliana


Alignment Length:75 Identity:23/75 - (30%)
Similarity:39/75 - (52%) Gaps:3/75 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRLA 87
            |:::.|:|||.|.::....:.|:..: ||...:..|:|:..|.|..  :|..|||.|.|...::.
plant    47 VINYGASWCGVCSQILPAFRKLSNSF-SKLKFVYADIDECPETTRH--IRYTPTFQFYRDGEKVD 108

  Fly    88 SFAGADEHKL 97
            ...||.|.:|
plant   109 EMFGAGEQRL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 20/69 (29%)
AT3G53220NP_566982.1 TRX_family 36..113 CDD:239245 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.