DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TRXF1

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_186922.1 Gene:TRXF1 / 821260 AraportID:AT3G02730 Length:178 Species:Arabidopsis thaliana


Alignment Length:95 Identity:34/95 - (35%)
Similarity:53/95 - (55%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEE-LTERYKVRSMPTF 77
            ::||.:||:|||.|..||||||.:....|:|:.||.. .|.||:|.:.... |.:...:|.:|||
plant    82 VKAAGEKLVVLDMYTQWCGPCKVIAPKYKALSEKYDD-VVFLKLDCNPDNRPLAKELGIRVVPTF 145

  Fly    78 VFLRQNRRLASFAGADEHKLTNMMAKLVKA 107
            ..|:.|:.:....||   |..:::|.:..|
plant   146 KILKDNKVVKEVTGA---KYDDLVAAIETA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 29/76 (38%)
TRXF1NP_186922.1 TRX_family 76..170 CDD:239245 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.