DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and AT3G04780

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_566238.1 Gene:AT3G04780 / 819638 AraportID:AT3G04780 Length:176 Species:Arabidopsis thaliana


Alignment Length:95 Identity:25/95 - (26%)
Similarity:40/95 - (42%) Gaps:33/95 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ADDKLIV---------LDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKF-----EELTE 67
            ||::|::         |..:|. .||.:|...|||.    :|:|..:...:|:.|     .||||
plant    56 ADEQLLIYIPFNQVIKLHSFAI-KGPEEEGPKTVKF----FSNKEHMCFSNVNDFPPSDTAELTE 115

  Fly    68 ----------RY----KVRSMPTFVFLRQN 83
                      :|    .|||:..|:...|:
plant   116 ENLKGKPVVLKYVKFQNVRSLTIFIEANQS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 25/95 (26%)
AT3G04780NP_566238.1 PITH 18..160 CDD:399305 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.