powered by:
Protein Alignment dhd and ATHM3
DIOPT Version :9
Sequence 1: | NP_001284882.1 |
Gene: | dhd / 31444 |
FlyBaseID: | FBgn0011761 |
Length: | 107 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001154520.1 |
Gene: | ATHM3 / 816050 |
AraportID: | AT2G15570 |
Length: | 174 |
Species: | Arabidopsis thaliana |
Alignment Length: | 70 |
Identity: | 16/70 - (22%) |
Similarity: | 37/70 - (52%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 IVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRRL 86
::::||.:|||||:.:...:..:|..|:.|.....::.|....:.|.|:::::|..:..:...:.
plant 88 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFKNGEKR 152
Fly 87 ASFAG 91
.|..|
plant 153 ESIMG 157
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000170 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.