DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and Txn2

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_445783.1 Gene:Txn2 / 79462 RGDID:71040 Length:166 Species:Rattus norvegicus


Alignment Length:98 Identity:30/98 - (30%)
Similarity:55/98 - (56%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVRS 73
            |:..|:..::.. :|:||:|.||||||.:...::.:..|...|.|:.|:|:|...:|...|:|.:
  Rat    69 DFQDRVVNSETP-VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSA 132

  Fly    74 MPTFVFLRQNRRLASFAG-ADEHKLTNMMAKLV 105
            :||.:.::....:..|.| .||.:|...:.||:
  Rat   133 VPTVLAIKNGDVVDKFVGIKDEDQLEAFLKKLI 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 23/76 (30%)
Txn2NP_445783.1 TRX_family 72..162 CDD:239245 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.