DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and Nme8

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_853622.2 Gene:Nme8 / 73412 MGIID:1920662 Length:586 Species:Mus musculus


Alignment Length:87 Identity:21/87 - (24%)
Similarity:42/87 - (48%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LIVLDFYATWCGPCKEMESTVKSLARKYSSKAVV--LKIDVDKFEELTERYKVRSMPTFVFLRQN 83
            |.|:|.|..||||||.::|..:.|..:.:...::  :..:.|....| :.::.:..|.|:|....
Mouse    29 LTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFVVAEADNIVTL-QPFRDKCEPVFLFSLNG 92

  Fly    84 RRLASFAGADEHKLTNMMAKLV 105
            :.:|...||:...:...:..|:
Mouse    93 KIIAKIQGANAPLINRKVITLI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 19/73 (26%)
Nme8NP_853622.2 TRX_NDPK 11..113 CDD:239246 20/84 (24%)
NDPk 155..301 CDD:260363
NDK 1 157..254
NDK 2 312..452
NDK 313..450 CDD:197791
NDPk_TX 313..445 CDD:239879
NDK 448..581 CDD:197791
NDPk 448..579 CDD:260363
NDK 3 453..586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.