DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TXN

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_003320.2 Gene:TXN / 7295 HGNCID:12435 Length:105 Species:Homo sapiens


Alignment Length:102 Identity:38/102 - (37%)
Similarity:68/102 - (66%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTER 68
            :.:...:.:.::||.|||:|:||.||||||||.::....||:.|||: .:.|::|||..:::...
Human     5 IESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSN-VIFLEVDVDDCQDVASE 68

  Fly    69 YKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAKLV 105
            .:|:.||||.|.::.:::..|:||::.||...:.:||
Human    69 CEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 32/75 (43%)
TXNNP_003320.2 TRX_family 11..102 CDD:239245 36/91 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.