DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and TXN

DIOPT Version :10

Sequence 1:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_003320.2 Gene:TXN / 7295 HGNCID:12435 Length:105 Species:Homo sapiens


Alignment Length:37 Identity:11/37 - (29%)
Similarity:19/37 - (51%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TEISSMRNHLRDFLIQIKEHNGEDTSDLYLEEREAEI 54
            ::|.:.:....|.||...  |.|:..:|.||:.:.||
Human   545 SDIINTQEMYNDDLIHFS--NSENCKELQLEKHKGEI 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_511046.1 CnoX 6..105 CDD:442352 11/37 (30%)
TXNNP_003320.2 TRX_family 11..102 CDD:239245
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.