DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and tmx3b

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001039026.1 Gene:tmx3b / 553250 ZFINID:ZDB-GENE-060901-5 Length:484 Species:Danio rerio


Alignment Length:84 Identity:26/84 - (30%)
Similarity:40/84 - (47%) Gaps:5/84 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYS---SKAVVLKIDVDKF 62
            :|.|..::|..|.....|..|:  ||||.|||.||::|...:.:..:.|   |...|.|:|...:
Zfish    18 LALVLDLDDSFKDSRMEDVWLV--DFYAPWCGYCKKLEPVWEEVGAELSRSGSPVRVGKMDATAY 80

  Fly    63 EELTERYKVRSMPTFVFLR 81
            ..:...:.||..||...|:
Zfish    81 SGMASEFGVRGYPTIKLLK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 22/68 (32%)
tmx3bNP_001039026.1 PDI_a_TMX3 27..123 CDD:239298 23/75 (31%)
Thioredoxin_6 153..328 CDD:290560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.