DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and NME8

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_057700.3 Gene:NME8 / 51314 HGNCID:16473 Length:588 Species:Homo sapiens


Alignment Length:87 Identity:19/87 - (21%)
Similarity:39/87 - (44%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LIVLDFYATWCGPCKEMESTVKSLARKYSSKAVV--LKIDVDKFEELTERYKVRSMPTFVFLRQN 83
            |.|:|.|..|||||:.|:...:.|..:.:...::  ...:.|....| :.::.:..|.|:|....
Human    29 LTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEADNIVTL-QPFRDKCEPVFLFSVNG 92

  Fly    84 RRLASFAGADEHKLTNMMAKLV 105
            :.:....||:...:...:..|:
Human    93 KIIEKIQGANAPLVNKKVINLI 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 17/73 (23%)
NME8NP_057700.3 TRX_NDPK 11..113 CDD:239246 18/84 (21%)
NDPk_TX 154..304 CDD:239879
NDK 1 157..257
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..261
NDK 2 315..455
NDK 316..453 CDD:197791
NDPk_TX 316..448 CDD:239879
NDK 451..586 CDD:197791
NDPk_TX 451..582 CDD:239879
NDK 3 456..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.