DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and txn

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001002461.1 Gene:txn / 436734 ZFINID:ZDB-GENE-040718-162 Length:107 Species:Danio rerio


Alignment Length:89 Identity:34/89 - (38%)
Similarity:56/89 - (62%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVV-LKIDVDKFEELTERYKVRS 73
            :...::.|.|||:|:||.|||||||:.:....|.|:.|..:|.|| ||:|||..:::.....:..
Zfish    11 FDNALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQDVAALCGISC 75

  Fly    74 MPTFVFLRQNRRLASFAGADEHKL 97
            ||||.|.:..:::..|:|:::.||
Zfish    76 MPTFHFYKNGKKVDEFSGSNQSKL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 32/76 (42%)
txnNP_001002461.1 TRX_family 9..104 CDD:239245 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.790

Return to query results.
Submit another query.