powered by:
Protein Alignment dhd and pdia3
DIOPT Version :9
Sequence 1: | NP_001284882.1 |
Gene: | dhd / 31444 |
FlyBaseID: | FBgn0011761 |
Length: | 107 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_989329.1 |
Gene: | pdia3 / 394954 |
XenbaseID: | XB-GENE-976328 |
Length: | 501 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 23/64 - (35%) |
Similarity: | 34/64 - (53%) |
Gaps: | 3/64 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 DDKLIVLDFYATWCGPCKEMESTVKSLARKYSS--KAVVLKIDVDKFEELTERYKVRSMPTFVF 79
|.|.::::|||.|||.||.:|...|.|..|... ..|:.|:|... .::..:|:||..||..|
Frog 389 DSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGDDPNIVIAKMDATA-NDVPSQYEVRGFPTIYF 451
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.