DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and txndc5

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:84 Identity:26/84 - (30%)
Similarity:40/84 - (47%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LDFYATWCGPCKEMESTVKSLARK-YS--SKAVVLKIDVDKFEELTERYKVRSMPTFVFLRQNRR 85
            :.|||.|||.||.:....:.|::| :|  |...:.|:|......|..|:.||..||.:..|...:
 Frog   316 IKFYAPWCGHCKNLVPIWEDLSKKEFSGMSDVKIAKVDCTAERALCNRFSVRGYPTLLLFRAGEK 380

  Fly    86 LASFAGA-DEHKLTNMMAK 103
            :....|| |...|.|.:.:
 Frog   381 IGEHEGARDLETLQNFVLR 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 23/72 (32%)
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303
PDI_a_ERp46 296..397 CDD:239303 26/80 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.