DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and Trx-2

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster


Alignment Length:98 Identity:40/98 - (40%)
Similarity:64/98 - (65%) Gaps:0/98 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTER 68
            |:...|...::..|..||:||||:||||||||.:...:..|:.:::...||||:|||:.|::...
  Fly     5 VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAME 69

  Fly    69 YKVRSMPTFVFLRQNRRLASFAGADEHKLTNMM 101
            |.:.||||||||:...::..||||:..:|.:::
  Fly    70 YNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 36/75 (48%)
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 38/85 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443463
Domainoid 1 1.000 82 1.000 Domainoid score I442
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I360
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146939at50557
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - P PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
1211.750

Return to query results.
Submit another query.