DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and CG18130

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:113 Identity:30/113 - (26%)
Similarity:55/113 - (48%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVD------ 60
            |.::|..:..:.:|...  |:|||.|:.|||||:.|..:::.           :|:||.      
  Fly    12 ADIQTDEELERFMERPG--LLVLDVYSEWCGPCQGMVGSLRK-----------IKLDVGGDNLHL 63

  Fly    61 ---KFEELT--ERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
               |.:.:|  :|:..||.|.::|:...|.:....|:|..||.:::.|
  Fly    64 AICKSDTITALKRFNKRSEPIWLFVTGGRAVNLLFGSDVPKLVSLLVK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 23/86 (27%)
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 30/113 (27%)
DUF4746 234..556 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.