DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and trx2

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_595954.2 Gene:trx2 / 2539898 PomBaseID:SPBC12D12.07c Length:133 Species:Schizosaccharomyces pombe


Alignment Length:101 Identity:37/101 - (36%)
Similarity:64/101 - (63%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTE 67
            :|.:..||:.||.|  ||:.|:||||.||||||.::..::.|:.: :.||..:.::.|||.::.:
pombe    33 AVESFGDYNTRISA--DKVTVVDFYADWCGPCKYLKPFLEKLSEQ-NQKASFIAVNADKFSDIAQ 94

  Fly    68 RYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
            :..|.::||.|..|:.:.|....|||...|::::||
pombe    95 KNGVYALPTMVLFRKGQELDRIVGADVKTLSSLLAK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 26/75 (35%)
trx2NP_595954.2 TRX_family 39..122 CDD:239245 33/85 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1873
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - oto101920
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16834
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.