DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and Txn1

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_035790.1 Gene:Txn1 / 22166 MGIID:98874 Length:105 Species:Mus musculus


Alignment Length:94 Identity:37/94 - (39%)
Similarity:62/94 - (65%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTER 68
            :.:...:.:.:.||.|||:|:||.||||||||.::....||..|||: .|.|::|||..:::...
Mouse     5 IESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSN-VVFLEVDVDDCQDVAAD 68

  Fly    69 YKVRSMPTFVFLRQNRRLASFAGADEHKL 97
            .:|:.||||.|.::.:::..|:||::.||
Mouse    69 CEVKCMPTFQFYKKGQKVGEFSGANKEKL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 33/75 (44%)
Txn1NP_035790.1 Thioredoxin 4..103 CDD:365862 37/94 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.