DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and trx-2

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001256207.1 Gene:trx-2 / 179434 WormBaseID:WBGene00007099 Length:145 Species:Caenorhabditis elegans


Alignment Length:105 Identity:25/105 - (23%)
Similarity:56/105 - (53%) Gaps:2/105 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTER 68
            :.::.|:.:::..:...:|| ||:|.|||||:.:...::..........::.||:||...||...
 Worm    42 IDSVEDFTEKVIQSSVPVIV-DFHAEWCGPCQALGPRLEEKVNGRQGSVLLAKINVDHAGELAMD 105

  Fly    69 YKVRSMPTFVFLRQNRRLASFAGA-DEHKLTNMMAKLVKA 107
            |.:.::||....:...:::.|:|. |:.:|.:.:..::.|
 Worm   106 YGISAVPTVFAFKNGEKISGFSGVLDDEQLDDFIEDVLAA 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 21/76 (28%)
trx-2NP_001256207.1 TRX_family 46..140 CDD:239245 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.