DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and Y55F3AR.2

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_500036.2 Gene:Y55F3AR.2 / 176929 WormBaseID:WBGene00021933 Length:254 Species:Caenorhabditis elegans


Alignment Length:96 Identity:35/96 - (36%)
Similarity:56/96 - (58%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTERYKVR 72
            :|:.::..|.:.|.:.:||.|:|||||:.:......||.:|.. :|.||:|||:.......|.|.
 Worm    10 SDFDRKFSAGNGKAVFVDFTASWCGPCQYIAPIFSDLANQYKG-SVFLKVDVDECRGTAATYGVN 73

  Fly    73 SMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
            :||||:.....::.|:..||||..|.:|:||
 Worm    74 AMPTFIAFVNGQKKATIQGADESGLRSMVAK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 26/75 (35%)
Y55F3AR.2NP_500036.2 TRX_family 10..103 CDD:239245 33/93 (35%)
DUF4605 157..212 CDD:373801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.