DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and W01B11.6

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_491139.1 Gene:W01B11.6 / 171903 WormBaseID:WBGene00020917 Length:109 Species:Caenorhabditis elegans


Alignment Length:99 Identity:24/99 - (24%)
Similarity:44/99 - (44%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELT-ERY 69
            |..|:.::.|....|..:..||...|..|:.::.....|.:||...|:|........::|| :.:
 Worm     8 TDEDFLQKSEHGIGKKAIYYFYGERCPSCESIKPLFDDLCKKYEKTALVYTYPCYNDDQLTGDAF 72

  Fly    70 KVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAK 103
            .|.::||||.:.....:....||:..|:..:..|
 Worm    73 AVNAVPTFVVMNNGEEVTRHVGAEAEKVQELFEK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 18/76 (24%)
W01B11.6NP_491139.1 TRX_family 21..105 CDD:239245 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.