DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dhd and XB5909790

DIOPT Version :9

Sequence 1:NP_001284882.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001123670.1 Gene:XB5909790 / 100170420 XenbaseID:XB-GENE-5909791 Length:105 Species:Xenopus tropicalis


Alignment Length:101 Identity:33/101 - (32%)
Similarity:61/101 - (60%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEELTER 68
            |.:::::...::.|.|||:|:||.||||||||.:....:.|:.: :...|.:|:|||..:::...
 Frog     5 VESLDEFQNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVE-NPDVVFIKVDVDDAQDVAAH 68

  Fly    69 YKVRSMPTFVFLRQNRRLASFAGADEHKLTNMMAKL 104
            ..|:.||||.|.:..:::..|:||::..|...:..|
 Frog    69 CDVKCMPTFHFYKNGQKVHEFSGANQASLIQKVQDL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dhdNP_001284882.1 TRX_family 17..93 CDD:239245 29/75 (39%)
XB5909790NP_001123670.1 TRX_family 9..100 CDD:239245 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.