DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_011725.3 Gene:TRX2 / 853123 SGDID:S000003441 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:94 Identity:43/94 - (45%)
Similarity:62/94 - (65%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||..:::..:.|..| .:.|||||:||:|.||||||:|||.:::.|:|||| ....|::|||..|
Yeast     1 MVTQLKSASEYDSAL-ASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSD-AAFYKLDVDEVSD 63

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCN 94
            :..:..|:||||.:|.|||..:...||.|
Yeast    64 VAQKAEVSSMPTLIFYKGGKEVTRVVGAN 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 40/82 (49%)
TRX2NP_011725.3 thioredoxin 6..104 CDD:200072 41/89 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1472
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9210
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
1211.680

Return to query results.
Submit another query.