DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX1

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_013144.1 Gene:TRX1 / 850732 SGDID:S000004033 Length:103 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:39/106 - (36%)
Similarity:63/106 - (59%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||...:...:.|.  .:|:|||||:||||.||||||:|||.:::.::|| .:....|::|||..|
Yeast     1 MVTQFKTASEFDS--AIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQY-PQADFYKLDVDELGD 62

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHA 106
            :..:..|::|||.:..|.|..:...||.|...:.:.:..:|
Yeast    63 VAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 35/91 (38%)
TRX1NP_013144.1 thioredoxin 6..103 CDD:200072 36/99 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I1788
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I1472
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9210
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.