DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TH7

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_176182.1 Gene:TH7 / 842266 AraportID:AT1G59730 Length:129 Species:Arabidopsis thaliana


Alignment Length:86 Identity:37/86 - (43%)
Similarity:56/86 - (65%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGG 84
            :||:||||.|.||||||.:.|::.|:|.:||: .|..:|:||...|:...|...::|.|||:|.|
plant    43 NKLLVIDFTAVWCGPCKAMEPRVREIASKYSE-AVFARVDVDRLMDVAGTYRAITLPAFVFVKRG 106

  Fly    85 NVLELFVGCNSDKLAKLMEKH 105
            ..::..||...|:|.|.:|:|
plant   107 EEIDRVVGAKPDELVKKIEQH 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 36/84 (43%)
TH7NP_176182.1 TRX_family 36..125 CDD:239245 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.