DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and THX

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_564566.1 Gene:THX / 841454 AraportID:AT1G50320 Length:182 Species:Arabidopsis thaliana


Alignment Length:69 Identity:25/69 - (36%)
Similarity:45/69 - (65%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVF 80
            :|...:.|:::|.|.||||||:|.|.::.|:|:|.|::.::|::.|.|..:..|:.|..:|.|:.
plant    83 VLESAQPVLVEFVATWCGPCKLIYPAMEALSQEYGDKLTIVKIDHDANPKLIAEFKVYGLPHFIL 147

  Fly    81 IKGG 84
            .|.|
plant   148 FKDG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 25/69 (36%)
THXNP_564566.1 CnoX 71..176 CDD:442352 25/69 (36%)

Return to query results.
Submit another query.