DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX5

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_175128.1 Gene:TRX5 / 841082 AraportID:AT1G45145 Length:118 Species:Arabidopsis thaliana


Alignment Length:88 Identity:39/88 - (44%)
Similarity:62/88 - (70%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGN 85
            ||:||||.|.||.||:.|||...|:|::::: ||..|::|||.:.:..|:.|.:||||||:|.||
plant    28 KLIVIDFTASWCPPCRFIAPVFAEMAKKFTN-VVFFKIDVDELQAVAQEFKVEAMPTFVFMKEGN 91

  Fly    86 VLELFVGCNSDKLAKLMEKHAGV 108
            :::..||...|::.:.:.||.|:
plant    92 IIDRVVGAAKDEINEKLMKHGGL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 36/83 (43%)
TRX5NP_175128.1 TRX_family 16..108 CDD:239245 36/80 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.