DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TO2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_564371.1 Gene:TO2 / 839988 AraportID:AT1G31020 Length:159 Species:Arabidopsis thaliana


Alignment Length:104 Identity:35/104 - (33%)
Similarity:59/104 - (56%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFY--ADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDEN--ED 65
            ::::.:.:..|..|.|..:...||  |.|||||::|:|.:.||:.:|.| |...||::||.  .:
plant    54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPCRLISPVILELSNKYPD-VTTYKVDIDEGGLSN 117

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEK 104
            ...:.||:::||..|.|||......||.:..:|..:||:
plant   118 AIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQ 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 35/96 (36%)
TO2NP_564371.1 TRX_family 58..146 CDD:239245 32/88 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.