DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ATTRX4

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_173403.1 Gene:ATTRX4 / 838562 AraportID:AT1G19730 Length:119 Species:Arabidopsis thaliana


Alignment Length:91 Identity:42/91 - (46%)
Similarity:61/91 - (67%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGG 84
            :||:||||.|.||.||::|||..::||:::....:..||:|||.:.:..|:.|.:||||||||.|
plant    28 NKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQSVAKEFGVEAMPTFVFIKAG 92

  Fly    85 NVLELFVGCNSDKLAKLMEKHAGVYT 110
            .|::..||.|.:.|...:.||.||.|
plant    93 EVVDKLVGANKEDLQAKIVKHTGVTT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 37/84 (44%)
ATTRX4NP_173403.1 TRX_family 20..110 CDD:239245 37/81 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.