DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ACHT5

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_200952.1 Gene:ACHT5 / 836265 AraportID:AT5G61440 Length:245 Species:Arabidopsis thaliana


Alignment Length:104 Identity:35/104 - (33%)
Similarity:57/104 - (54%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVE 69
            :::.:.|...|:.|.|:|||:|||:..||.||.:.||:.:||:. :..|:.||||.:|...:...
plant    90 IQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLAET-NPNVMFLKVNQEELRTMCHG 153

  Fly    70 YNVNSMPTFVFIKGGNVLELFVGC---NSDKLAKLMEKH 105
            .||:.:|.|.|.:|.........|   ..:|..|.::||
plant   154 LNVHVLPFFKFYRGAEGKVCSFSCTIATINKFKKALDKH 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 32/94 (34%)
ACHT5NP_200952.1 TRX_family 103..>169 CDD:239245 28/66 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.