DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX3

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_199112.1 Gene:TRX3 / 834313 AraportID:AT5G42980 Length:118 Species:Arabidopsis thaliana


Alignment Length:102 Identity:43/102 - (42%)
Similarity:64/102 - (62%) Gaps:3/102 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLDQQLILAED--KLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYN 71
            :|..::|..|.:  ||:||||.|.||.||:.|||...:||:::.| ||..||:|||...:..|:.
plant    14 EDWTEKLKAANESKKLIVIDFTATWCPPCRFIAPVFADLAKKHLD-VVFFKVDVDELNTVAEEFK 77

  Fly    72 VNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGV 108
            |.:||||:|:|.|.:.|..||...:::...:|||..|
plant    78 VQAMPTFIFMKEGEIKETVVGAAKEEIIANLEKHKTV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 39/93 (42%)
TRX3NP_199112.1 TRX_family 18..109 CDD:239245 38/91 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.