DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRX2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_198811.1 Gene:TRX2 / 833992 AraportID:AT5G39950 Length:133 Species:Arabidopsis thaliana


Alignment Length:89 Identity:38/89 - (42%)
Similarity:59/89 - (66%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVF 80
            |...:||:|:||.|.|||||::|.|.:..:|.:::| |..:|::|||..|:..|:||.:|||||.
plant    43 IKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFND-VDFVKLDVDELPDVAKEFNVTAMPTFVL 106

  Fly    81 IKGGNVLELFVGCNSDKLAKLMEK 104
            :|.|..:|..:|...|:|.|.:.|
plant   107 VKRGKEIERIIGAKKDELEKKVSK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 38/89 (43%)
TRX2NP_198811.1 TRX_family 39..128 CDD:239245 37/85 (44%)

Return to query results.
Submit another query.