DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TRXF2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_197144.1 Gene:TRXF2 / 831501 AraportID:AT5G16400 Length:185 Species:Arabidopsis thaliana


Alignment Length:87 Identity:34/87 - (39%)
Similarity:54/87 - (62%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVD-ENEDITVEYNVNSMPTFVFI 81
            |.||:||:|.|..||||||:||||..||:::|.| :|.||::.: :|:.:..|..:..:|||..:
plant    95 AGDKIVVLDMYTQWCGPCKVIAPKYKELSEKYQD-MVFLKLDCNQDNKPLAKELGIRVVPTFKIL 158

  Fly    82 KGGNVLELFVGCNSDKLAKLME 103
            |...|::...|...:.|...:|
plant   159 KDNKVVKEVTGAKYEDLLAAIE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 34/87 (39%)
TRXF2NP_197144.1 TRX_family 86..180 CDD:239245 33/85 (39%)

Return to query results.
Submit another query.