DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and HCF164

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_195437.1 Gene:HCF164 / 829874 AraportID:AT4G37200 Length:261 Species:Arabidopsis thaliana


Alignment Length:78 Identity:29/78 - (37%)
Similarity:45/78 - (57%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDEN--EDITVEYNVNSMPTFV 79
            |:..|..|::||||||..|:.:||.:.::.|||.|:|..:.:|||..  |....|:.|..:|.|.
plant   135 LSNGKPTVVEFYADWCEVCRELAPDVYKIEQQYKDKVNFVMLNVDNTKWEQELDEFGVEGIPHFA 199

  Fly    80 FI-----KGGNVL 87
            |:     :.|||:
plant   200 FLDREGNEEGNVV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 29/78 (37%)
HCF164NP_195437.1 TxlA 119..260 CDD:239248 29/78 (37%)

Return to query results.
Submit another query.