DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ACHT2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_849469.1 Gene:ACHT2 / 829088 AraportID:AT4G29670 Length:236 Species:Arabidopsis thaliana


Alignment Length:84 Identity:33/84 - (39%)
Similarity:51/84 - (60%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIK 82
            |.::||:::||..||..|:.:.|||.:.|.::.| :|.||||.|||:.:....||..:|.|.|.:
plant   121 AGERLVIVEFYGTWCASCRALFPKLCKTAVEHPD-IVFLKVNFDENKPMCKSLNVRVLPFFHFYR 184

  Fly    83 GGN-VLELFVGCNSDKLAK 100
            |.: .||.| .|:..|:.|
plant   185 GADGQLESF-SCSLAKVKK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 33/84 (39%)
ACHT2NP_849469.1 TRX_family 112..213 CDD:239245 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.