DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TTL4

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_191421.2 Gene:TTL4 / 825031 AraportID:AT3G58620 Length:682 Species:Arabidopsis thaliana


Alignment Length:62 Identity:19/62 - (30%)
Similarity:34/62 - (54%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTF-VFIKGGNVLELFVGCNSDKL 98
            |:|.::.|..:| ..|...||:|:|:..:....::..:||| ::.||..|.|:.  |.|.:|
plant   614 ISPFVNTLCLRY-PLVHFFKVDVEESLALAKAESIKKIPTFKIYKKGEKVKEMV--CPSHQL 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 19/62 (31%)
TTL4NP_191421.2 TadD <204..302 CDD:444034
TPR repeat 215..239 CDD:276809
TPR repeat 244..274 CDD:276809
TPR repeat 279..302 CDD:276809
TPR 401..>574 CDD:440225
TPR repeat 402..430 CDD:276809
TPR repeat 482..512 CDD:276809
TPR repeat 517..541 CDD:276809
TRX_family 589..674 CDD:239245 19/62 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.