DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and AT3G56420

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001325846.1 Gene:AT3G56420 / 824809 AraportID:AT3G56420 Length:154 Species:Arabidopsis thaliana


Alignment Length:117 Identity:39/117 - (33%)
Similarity:65/117 - (55%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILAED--KLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENE 64
            |:||...:..::::..|.:  |::|::|.|.||.|||.|.|...:||.:|...:.| .|:|:|..
plant    42 VHPVSRIEKWEEKITEANNHGKILVVNFSAPWCVPCKKIEPVFRDLASRYPSMIFV-TVDVEELA 105

  Fly    65 DITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGVYTDEAADV 116
            :.:.|:||.:.||.||:|.|..::..||..:.:|.|        .|..|||:
plant   106 EFSNEWNVEATPTVVFLKDGRQMDKLVGAETSELQK--------KTAAAADL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 32/93 (34%)
AT3G56420NP_001325846.1 TRX_family 49..142 CDD:239245 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.