DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and AT3G53220

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_566982.1 Gene:AT3G53220 / 824488 AraportID:AT3G53220 Length:126 Species:Arabidopsis thaliana


Alignment Length:101 Identity:25/101 - (24%)
Similarity:46/101 - (45%) Gaps:9/101 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DQQLILAEDKL------VVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEY 70
            ||..:...|.:      .||::.|.|||.|..|.|...:|:..:| ::..:..::||..:.|  .
plant    29 DQSFLTILDDIKSSKSPAVINYGASWCGVCSQILPAFRKLSNSFS-KLKFVYADIDECPETT--R 90

  Fly    71 NVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHA 106
            ::...|||.|.:.|..::...|....:|...:..|:
plant    91 HIRYTPTFQFYRDGEKVDEMFGAGEQRLHDRLWLHS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 22/97 (23%)
AT3G53220NP_566982.1 TRX_family 36..113 CDD:239245 20/79 (25%)

Return to query results.
Submit another query.