powered by:
Protein Alignment TrxT and PRXQ
DIOPT Version :9
Sequence 1: | NP_001284881.1 |
Gene: | TrxT / 31443 |
FlyBaseID: | FBgn0029752 |
Length: | 157 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189979.1 |
Gene: | PRXQ / 822203 |
AraportID: | AT3G26060 |
Length: | 217 |
Species: | Arabidopsis thaliana |
Alignment Length: | 52 |
Identity: | 13/52 - (25%) |
Similarity: | 19/52 - (36%) |
Gaps: | 15/52 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 KGGNVLELFV------GCNS---------DKLAKLMEKHAGVYTDEAADVKA 118
||..|:..|. ||.. :|..|...:..|:..|::|..||
plant 95 KGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKA 146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.